dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A193PDL4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A193PDL4|A0A193PDL4_PLAFA) Duffy binding-like merozoite surface protein 1 {ECO:0000313|EMBL:BAV14345.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=mspdbl1 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence length 529
Sequence
MKKIYSIFFSLFILNLHIYIKNIKCNDLINYNDSNLRNGLLNNSLDLTNGLNNKDNSFID
SKIEEHENKSYQNKDNNISIVGQDVPITSVDSSKIINANDLEGNSIDDTKGLSVTNSGFD
DGSAFGGGLPFSGYSPLQGNHNKCPDENFCKGIKNALSCPPKNSTGRNGDWIPQYLRWFR
EWGTYVCSEYKNKFENVIELCNVRQITNQNDSQLLEISKKDKCKGALKHYEEWVNRRRPE
WKGQCDKFEKEKSKYEDTKSRTAEIYLKEICSECDCKYKDLDNTFKEFKDNVTLLKAVID
NKKNQDSLTTTSLSTSINSVRDSSNLDQRGNITTSQGNSHRATVVQQADQTNRLDNVNSV
TQRGNNNYNNNLERGLGSGALPGTNIITEEKYSLELIKLTSKDEEDIIKHNEDVREEIEE
QQEDIEEDEEELENEGEETKEEDDEEKNEIEEENKEKELSNQQQSEKKSISKVDEDSYRI
LSVSYKDNNEVKNVAESIVKKLFSLFNDNNNLETIFKGLTEDMTDLFQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]