dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A194SD15 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A194SD15|A0A194SD15_RHOGW) Uncharacterized protein {ECO:0000313|EMBL:KPV78628.1} KW=Complete proteome; Reference proteome OX=578459 OS=Rhodotorula graminis (strain WP1). GN=RHOBADRAFT_51073 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence length 1422
Sequence
MAAPPVAPATPTRDHDPASLRSPIVLSTRSPAAPRPASVLIQNVRGAEGGVEAITARRRN
SGSFKTMSTGGLVSNSPFAKRLGQTSPTKSAASSPTSTLYTSSRIPAPSSSSTSGGASSA
RRTSGSRQSSGEQEQGPVKENSIPSDLNELATAKDDDSKSRSSSPAVPFRPTRQQAPASS
PFKPSRSPIDEPAQPRRQTSSYAHLRSNNLVSSSPFTAQQAAPSPELQQVPYEIGALTLE
SAPMELFYDDSSSAGDRSPHLDVGLGARPGQGVLGPVSRHAAGASAPPPVSPPPPSSTST
SSAMAPVRRGMRGPRPLSGDAADDLAEEQGRVVRRQPSSKSVAWAETEEVFEFEVEEERR
RSMMSDASGLSDEGYYGRRGAGEEDDEDSSFEDDGYGAQHASYSFEEGGSVEVHDVDDGA
SDAEESVVSNTSSAMDEVIGQIDSYLHEESYDAADVFSPSQILDGDHDHGEFADQPDLPT
HHDTSGYSSPAVPQQRGPVSAFSVSTADDGASDVMSTSAYGDDDDQDERDAHFDATRQAI
MGRALGAPVPPVPMSPGRPPLPPRPASATSPATRADPIPGSLLAHSDSQFSLPDIPGTSP
FMGFEDDGTAGSVVSLANNAKPHAAATVPTTRPLSLHSHMAVATSTPVKAARAEPAEETT
PTKSTPSSTATRGLGLAPSSSAGSPILAALHRSPDAATATLVPPGSASPALSRKASLVGS
DVTTSSTSWYVSSVTGSLRGGRIGSGLESTMKRHEAILGSPFMPSSSGAFGAFPKPSTPA
PALSVETASPARSASTMGSTGKSTPPTSHASTAGSSDAAGGGVAPRSLKSARAIEARPAL
KAHGATLSSGMMPTIAASSQRAQLGLSVGSPLTARVAEEMQSPLERLQMGVQGRGEGAEW
RDGDSLLGGAEGDEAGDEVSSLRPGAGAGAGGAVKRLQRRRSRSTGDADLAETTSSVGAQ
HTMPELGFEQQRGGEGGAFGSSVLESLDDIYNSRNRTYRVRESKHLVVVSDIAGHTAGDV
DPGKAWRKKRPSNVHEINRSMSTMSVNSQAVRKNREFAGQLFVLIREASFEGMPLPRTKA
MVTATLDNGRQRVDVAVRELGNKVSLRKEFELACNQDLAFSIDFSVPRQTPVSTPVLPST
PSVPAPTPPASPSKAHRAFRIFSSPKKKAAQAPARPTSTLAAAPPPTPDPFYDYVSSNGQ
LATAHVTFATEAAACRLKKTRVVLPFGAKTVGSPRSCSGSLEIDLLFVPAVQGVPKAHLP
KSMDEVLDGLERADFATKVVHESVLTQLGGDTTVWRRRVVKLRGSTLVPYNEVTKRSHVE
INLAQVVAVEDLNAPSSTSRAAARDDDDDDESVTRMDHSFRLVFEDGNRIDYFADSHAIK
TKWLEVLAAVVGQDGDKKTAPDWAVAVRKLPPPKALALKAAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]