dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1B2AK02 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1B2AK02|A0A1B2AK02_DROME) Eukaryotic translation initiation factor 5A {ECO:0000256|RuleBase:RU362005} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN= OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 159
Sequence
MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMV
GIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGE
LGEQLRLDFDSGKDLLCTVLKACGEECVIAIKTNTALDK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]