dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1F0J7B2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1F0J7B2|A0A1F0J7B2_9PSED) NQR-1 subunit F {ECO:0000256|HAMAP-Rule:MF_00430} KW=Complete proteome OX=1739516 OS=Pseudomonas sp. HMSC065H01. GN=HMPREF3014_10000 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 406
Sequence
MGFEIFLAIGMFTAIVLGLVAIILVARAKLVSSGDVTIQINGEHSLTVPAGGKLLQTLAA
NNVFLSSACGGGGTCAQCKCVVVEGGGEMLPTEESHFTRRQAKEGWRLSCQTPVKQDMQI
RVPEEVFGVKKWECTVESNPNVATFIKELTLRLPDGESVDFRAGGYVQLECPPHVVEYKD
FDIQSEYRGDWDKFNMWRYVSKVDETVIRAYSMANYPEEKGVVKFNIRIASPPPGSDLPP
GQMSSWVFNLKPGDKVTVYGPFGEFFAKDTEAEMVFIGGGAGMAPMRSHIFDQLRRLKSN
RKISFWYGARSLREAFYTEEYDQLQAENPNFQWHLALSDPQPEDNWTGLTGFIHNVLFEN
YLKDHPAPEDCEFYMCGPPMMNAAVIKMLTDLGVERENILLDDFGG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]