dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1I8BEN1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1I8BEN1|A0A1I8BEN1_MELHA) Uncharacterized protein {ECO:0000313|WBParaSite:MhA1_Contig210.frz3.gene7} KW=Complete proteome; Reference proteome OX=6305 OS=Meloidogyne hapla (Root-knot nematode worm). GN= OC=Meloidogyne.
Sequence length 213
Sequence
MQAKAKQLEEERLKKEKDKEGQCGPEEVPCPETATIRCIHYTSLCDNVDDCGDGYDESNC
VSSESRDEEKIITISPENVINAYCAPGEFQCRDGSCIPDSSRCNRNYDCGLTDGSDEEGC
AYWKEAEEAERRRKEEEQKQLAEYHEQQRQRAEEEKNRRIEECRRRGGFLCPGQDKCVER
SNVCDGRSDCANGDDEKNCPVSEEETGWFINFI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]