dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1S0UIL2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1S0UIL2|A0A1S0UIL2_LOALO) Uncharacterized protein {ECO:0000313|EMBL:EJD75373.1} OX=7209 OS=Loa loa (Eye worm) (Filaria loa). GN=LOAG_17465 OC=Spiruromorpha; Filarioidea; Onchocercidae; Loa.
Sequence length 932
Sequence
MSDASIGCYLVRFYCHSLRLRFLLTAAYSGSANNVPLRNARCTPDNWCVAKCCLSNYIFF
PRRNYTFQMSLFKTDAVGKITPLSEHVTALSWDGVSQKALELTLSRSSEDTLEISWEHPS
IDITNGFLQKYVIEYYKDSESLREVKRKDILPNSTICLLNGIKSEVVYRFRVIPVTRHGL
PSDVYLKSNPNFTSIGHMVESTNKNFRSVIGSLPIDIEQMGTSIIIHWEVRETSNFTSQD
PKNQAVLIRYAPSDLSPLREKAEEGLFINGAMNLTEKFDASRTYQFCSRLYDGLFYGPDF
CRTYRLPPATFADIFSSFSSGNGLPRAVLCHHRKECRCEPSYEFGDAMRVTWDWPIDDHS
ADEFVVHYTLSDSFFPEDDRLVITDEAFADLPSLRSNTTYRIMIEPRNKMGGVEGSWFNC
TTPILGQIPAPTGVMYEELNATAVRVSWNPIHPNPRWSTPVGYVIQVQSSSTSMAPVKDI
LVDGISATSHVITLQPNMLYTFQVAARSNAGDLGQRSSPYLFAPSQISKPGRIDVRRPKM
FPKSSREGILIGIVLVVGLLTLCFGGICAHLRLKRRKLEMGINANAANRGTNGSRNITNY
EMESLITRRRSELIDAPGRNIPRDSLMHNQLNPQNSISNEVEVICLDTKGGEQGALPSGQ
DKYLRLLNDKKQLQRFKECFLFNGLSEESSVKSHISCRKKTKNVNRRNEPFTIMAKRSNY
KLLDSKWIRAACDTSDPWTGSLPSKKRVVRLGSTSTRTVKTCYLMTGRMSISNFDIMMPR
FLSKLTALSDNTRRNAASHVESLNQAISYTSIICPRSASVQSLYQRNGFIKQKNDSVKTS
VAITTNNYMNYPCNTPSSQSLTWYDAGSIENDGIMRLPRDTPKLHGNSNKGATMLCCSMP
NLTDSGIVYDEMHFPRPPPLSPPPLDNKHLEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]