dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1S3FYW6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1S3FYW6|A0A1S3FYW6_DIPOR) low-density lipoprotein receptor-related protein 3 isoform X1 {ECO:0000313|RefSeq:XP_012881751.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Lrp3 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence length 773
Sequence
MEKPAAGAPEGAPGPRAQLAVVCLVNFFLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAASPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQVACQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGGSSESEDGSGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQY
PCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQ
DGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLE
AEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSR
RRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGFLQPASGVAPDPPAPQTDTGSPQ
VAGGGPSIGPGHTAEVGSSGPSSLSGLQDSERTPADKDIKTPRESVTDSPGPGDTSPEPC
LARDPQPQAPTTTSSSSSSSSTHSPESLGVCRSPPPPCSPTSEASDDDALLVC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]