dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1U7RDX0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1U7RDX0|A0A1U7RDX0_MESAU) wiskott-Aldrich syndrome protein {ECO:0000313|RefSeq:XP_005085183.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Was OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence length 515
Sequence
MSGVPVGGRPAGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATAVVQLYLALPPG
AEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGD
DCQVGLNFSDESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPTNEERRGGLPPLPPH
PGGDHGGPSGSPISLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGI
EAVRQEMRRQEPLPPPPPPCRGGGGGGGGGEGGGSQLLRPPIAGSNKGRSGPLPPVPGGG
APPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPVPGAGGPPAPPPPPPPPPPPPPCTE
SGPAPPPLPPTSASARGPAPGGGRGALLDQIRQGIQLNKTPGAMENSVQQPPPQRSEGLV
GALMQVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]