dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1V5SSS3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1V5SSS3|A0A1V5SSS3_9EURY) STAS domain protein {ECO:0000313|EMBL:OQA57557.1} OX=1852878 OS=Euryarchaeota archaeon ADurb.Bin294. GN=BWY45_01453 OC=Archaea; Euryarchaeota.
Sequence length 134
Sequence
MASPDVETDLIYTLKKEAGSALPIDIWYEGEMWIFHPIGSIDTTTSSDLEGTLIEGINQG
MRWIILDLTDVRYISSAGIRVFIAAAKTLKEKKGELLFSTPNKNVSDILRLSGLFKIFKV
YPDNAAAIRSFTVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]