dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1W5CFI8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1W5CFI8|A0A1W5CFI8_9NOST) Cysteine desulfurase {ECO:0000256|SAAS:SAAS00645443} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_19000 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence length 420
Sequence
MTYTPTKTLADKVRADFPILREEVNGKTLVYLDNAATSQKPLFVLNALRDYYEQYNSNVH
RGAHTLSAKATDAYEGARDKIAKFINAASRQEIVYTRNASEAINLVAYSWGMNNLQAGDE
IILSVMEHHSNIVPWQFVAQKTGAVLKFVELTPEQTLDMEQFKQLISEKTKLVSIVHVSN
TLGCINPVAEIAEITHRYGAKFLVDACQSVPHMPIDVQQIDCDWLVASGHKMCAPTGIGF
LYGKLALLEAMPPFFGGGEMIAEVYLDHSTYAELPHKFEAGTPAIGEAIALGAAIDYLTD
IGMDKIHAYEAELTAYLWQKLEQIPQITLYGPTPDAHGGGRAALATFTIEGIHANDLSTL
LDQEGVAIRSGHHCTQPLHRHLGLAGTARASLSFYNTREEIDVFIKALKETIDFFAGIFG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]