dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1W5CKC5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1W5CKC5|A0A1W5CKC5_9NOST) Nitrogenase metalloclusters biosynthesis protein NifS {ECO:0000256|RuleBase:RU364075} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_11225 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence length 398
Sequence
MSVIYLDNNATTQVDAEVLAAMLPYLTEFYGNPSSMHTFGGQVGKAVQQARGQVAFLLGA
EESEIIFTSCGTEGNNAAIKAALAAQPEKRHIITTQVEHAAIINVCKQLEKQGYKVTYLS
VDSQGQIDLLELEAALTGDTALVSTMYANNETGVVFPIEQIGLRAKDAGAIFHVDAVQAV
GKVPLNLKTSSIDMLTLSGHKLHAPKGIGALYIRRGVRFRPLLVGGHQERGRRAGTENVP
GMIALGKAAELAQIHLKDVKREKALRDRLEQGLLSAIPNTEVNGHPTSRLSNTTNIGFKY
IEGEAILLSLNKYGICASSGSACTSGSLESSHVLRAMGLPYTILHGSIRFSLSRYTTEAE
IDKVLQLMPPIVERLRAISPFSNDQADWLQGREEALAH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]