dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1W9W4K6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1W9W4K6|A0A1W9W4K6_9CHLR) Uncharacterized protein {ECO:0000313|EMBL:OQY43347.1} KW=Complete proteome; Reference proteome OX=1972460 OS=Anaerolineaceae bacterium 4572_78. GN=B6242_14835 OC=Bacteria; Chloroflexi; Anaerolineae; Anaerolineales; Anaerolineaceae.
Sequence length 788
Sequence
MNILNQSSKFDFLDNLNIGRKLGLAFSLLIMLSIIFGVMLFVMENLVKTMFEEVHNADKV
ASLARQIEVELLEMRRNEKNFLLRYSGQSFEGAYGNYVLPNQQHFQTLLDLLTEIRSIIP
AETEREVRYASFLDKLETATHDYQTVFNNLVENIRIRGDQNYGLTGDVLEMLDTLDKEID
ETNESDIKITSSNLRKAYLSYLHFGFQSTGYNYTEQPVQKHIDNFREGTKQLQTLIKSHN
NLSASKRENLSIITKEIQSMFEQLLMLDNEIIEHEKQLAMNARSITTLAGRIISNEEERQ
TETFAEFITLQNRYVIAGIVLFITTILSSVILAVIFTRSIAMPITHLTAIATQIAQAPTL
DAWTGKFDLTRQDEIGMLAKDFNYMTIRLQTLIADLQEREQKYRTIFEESKDVLFVTTAE
GQLIEVNPACKEIFGYTIEEAKLLNVVSFYAFPEDRQRFRNAVESEGFVKNLNLKMRRRD
DKIIDCLVSATLHYDPSGNFMGYQGIIHDMTAQKHVETERLKLTAIRRELSIAKNIQHNL
LPPNKPNWHGVEVVCFTQSAQEIGGDLYAYHAFPPTLDPMTGEVIGGRYGIAVGDVSGKG
ISAALLMALTMSTFKSTVQQFLEPPDLLAQMDKTLMTYTKKSRQNCAFVYVEFDIDLTGI
RRGTMVNAGCSMPLIRRHDGTVDEIEIGGMPLGVGLGSQSGYMSTEVELQRDDMVILMSD
GLPEAMNEHNEMFGFERLMYAVKSFSNQDLKGFQNISGLMLEHIKDKVMAFIGDAEPHDD
LTIVVVQV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]