dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1Y3DQG4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1Y3DQG4|A0A1Y3DQG4_PLAKN) Putative Merozoite Surface Protein 8-MSP8 {ECO:0000313|EMBL:OTN67061.1} KW=Complete proteome OX=5850 OS=Plasmodium knowlesi. GN=PKNOH_S07469500 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence length 476
Sequence
MKKNAQIIIFFLFGLLSCTCGAEGNVNPPNNNGNKGNGNDNNVPTFIGGNNNNVNDNGDD
IFNKNGKDVSRNDGNHAENPNDKKNENGSGSNEKNSVENADNGSGKSDANTNQNGEDANK
VDEASLKKILKIVDEMENVQGLLEGDYSILDKYSVKLVDDDDGETNKKKMIGEYDLKMLK
NILLFREKISRNCENKYITILPELLKKCSNVDDPKLSKASEKIKKGLTKNNISIEDFVIS
MLEDLFDKINEKFIKDYSFDLNDYLIDFELINYIIMQDTSDLINDLLNMLKSMNFKLESA
SLDKMVKNAQSGMNLNSKMKEDIIQLLKKSSAKFFKIEIDRKTKMIYPVQVTHKGATMKQ
FALNFLEKNNVCEHKKCPLNSNCYVIDGEEVCRCLPGFSDVKIDNVMNCVRDDTVDCNNN
NGGCDVNATCTLIDKKIVCECKDNFQGDGIYCSYSIFNSINNFIFLILLLLCLYLF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]