dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1Y5ZX93 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1Y5ZX93|A0A1Y5ZX93_BACCE) 8-amino-7-ketopelargonate synthase {ECO:0000256|RuleBase:RU003693} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BACERE00183_01957 OC=Bacillus cereus group.
Sequence length 394
Sequence
MNQTWRTHLQSKLQQLHEREQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERL
KEAAIACTRKYGTGATASRLVVGNYSLYEEVERSICDWKGTEKALVVNSGYTANIGVISS
LVSRHDIVFSDKLNHASIVDGIILSGAEHKRYGHNDLDHLEKLLKTASPEKRKLIVTDTV
FSMDGDTAYLRELVELKEKYGAILIVDEAHASGIYGIGGAGLSHIEDLAQKIDIHMGTFS
KALGCYGAYLTGDAIYIEYLHNMMRSFIFTTALPPGTLGAVQKAIEIVQEDHKRRENLIA
NGEYFRSKLRDAGFNIGNSSTHIVPIVVGSNENALRFSKRLQEAGIAAIAIRPPTVPINS
SRIRFAVTSQHTIADLKWAIDRIIHIAKEEELFV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]