dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A210PGN8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A210PGN8|A0A210PGN8_MIZYE) Low-density lipoprotein receptor-related protein 12 {ECO:0000313|EMBL:OWF35627.1} OX=6573 OS=Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). GN=KP79_PYT13857 OC=Pectinoida; Pectinoidea; Pectinidae; Mizuhopecten.
Sequence length 939
Sequence
MELQLLRTASAFSYHHTLHTLPVSNNSGFRSPVLILDTPELGRLNTEVHHGGHSNPVSLT
RKESRSHAVVRWILRLTVQKLPKWKHQRSCDCQTGQPRSVVEICRQVDKIEHLLSTVINN
NKITSFNSHSSDHDDVALSIAVSVLYLLISCAGAQSTDSCKSEEYNKNHGTITSPDYPAH
YPTNFCKDWFITGNTNDIITISFKMFDVETGILGNCGRDYLEIGPHPKVKLCGNTSSITS
RVYISTAKHVRIHFSSDYMTTGAGFELMYIMGPLQTKRCEQDQFRCHSGKCIFNEWRCNG
LAECEDHSDEANCPHETHSTTPPTTHICTNSTLLCEDIGTGRNRCIPKAQWCDGEKDCLH
GEDEDSKLCPSFKCNSHIDSQTGFVVSPNFPHDYPNNLSCTWTIHVQDTKAQVQLRFIKF
ELQKEAGTDFLTVYDGTYHEGKVIGVYFGGLADVPTMVESTTDYVTLKFTTNRVRAESGF
NITFQKKGVCLPDQSSCGTAEKDCFPTDKACDGVWNCRLHGGDEKGCGGCDKEHFRCGLK
GSHQCYEEKQRCNGISRCAELDDELNCNSVLCGSHNGTFLCDNKRCIYETWKCDKTNDCG
DNSDETDCPRSTNLITIAAVAGSLICALLLVVAMGCTCKLYNLRMQQFHGPRHETPLTRM
YAEFMRRRAPPPYHEAMLTSRPYDEVRQELAEQNNQNETAGSRTRRHRRRTARLPHRQQI
ASNSTAGQSSQQNDSCSTDTTSNQQTEGNQGPGESSQTINSSNLTWNTDSHSSTLALIPD
NSSDTTEGPDESGDESDQPDGEHVSFSRDIGITARWQRPRNSGKESSSSECQNLLQADPP
DSPLSAGRGSGDVTTTSCDSVDPSSIITENTNTRDSDNESDKSCDTDLLGASSSLLRQDE
SLISFTDRGLGEAQHETSDSSSDTDAITMGESSSHSELF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]