dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A226NAJ0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A226NAJ0|A0A226NAJ0_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB64636.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_008712 OC=Odontophoridae; Callipepla.
Sequence length 209
Sequence
IRHEEKTCYKAVQTSEEGPSEYQGPLMVLAQNCAVMHNLLGPACIFLRKGFAENRQPDRE
LRPEEIEELREAFKEFDKDKDGFINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHV
DFEDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMKKLLGQQVGH
RDIEEIIRDVDLNGDGRVDFEEFVRMMSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]