dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A286XJ82 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A286XJ82|A0A286XJ82_CAVPO) SH3 domain containing GRB2 like 3, endophilin A3 {ECO:0000313|Ensembl:ENSCPOP00000025373} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=SH3GL3 OC=Hystricomorpha; Caviidae; Cavia.
Sequence length 332
Sequence
QLFSEKISGAEGTKLDDEFLDMERKIDVTNKAVAEILSKATEYLQPNPAYRAKLGMLNTV
SKIRGQVKTTGYPQTEGLLGDCMLKYGKELGDSTFGNALIEVGESLKLMAEVKDSLDINV
KQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKE
LAERSMFNFLENDVEQVSQLAVFVEAALDYHKQTTEILQDLQRKLQMRISAAASVLRREY
KPRPVKRSPSELNGVSSTSTAKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLT
NQIDENWYEGIIHGESGFFPINYVEVIVPLPQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]