dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A287B395 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A287B395|A0A287B395_PIG) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSSSCP00000050746} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LRP3 OC=Sus.
Sequence length 592
Sequence
MEKRAAAGPEGAPGARAQLAVVCLVNIVLTGRLSSAVPALGEASTSQPPLLTAACSGKLE
QHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGP
AAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQA
DEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCL
PAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDT
QDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYH
ARARSAGHGFNATYQVKGYCLPWEQPCGSSREGDAGDAGEQGCFSEPQRCDGWWHCASGR
DEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCI
FETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQ
EYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQVSQRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]