dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2G5E9G3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2G5E9G3|A0A2G5E9G3_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA52393.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01000338v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence length 623
Sequence
MDSMLHHTSNIPNFFKVMVGDFQKKLSLPKALTLCFKPKVPKMFTLISPTGSSWMVSVKR
VDKDFFLANGWKTFAEDYALELGEFVVFRYKGDNAFSVKVFGKNACEKEVPSTNKNIEEV
ANHVTSKYPMFTTTVPKGDLTWYTTLIIPKLFAKKYLKNNHLGLTRDVTLRVTTGGTWNL
RYSVGVHRRLIGGWKTFVVGNNLKARDILVFELVDRNPIQMNCLPTDYIKNFNGDVPKQF
ILTSSTRRFWEVFVKKIDNNLFLSEQWPIFAKDNALEFGDLLVFIYNGNLEFRVKIFGSN
ACEKDVELALKNNVESDFYLREEKEGNDRGIPDKLHSPDILKCYKRRRTAEAAVTDKVTS
LPNSMSIKTERSEVMEVGLSFNATFQPSRKYKIGIPNEIVKEKGLSVKDKMLLLDPCGRS
WPVTIYCWSKGRTFLTAGWPAFCKANRLNTNDTCHFQFIDGVDNAIRVEIFRTRTPPPIA
KQASAGVKMSTAIPREVIEAPTRKRPGEFVDDRVIHNGKQESLLMTDCSNNDEQTMSTAP
NVAVLPSAFAKKHMKHAPRGVILRDSNGGTWHAQYKIGSHHKLNMGWKTFVFDNHLKECD
VCIFELVDENLTHYELKVTIIRH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]