dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2I3LFI3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2I3LFI3|A0A2I3LFI3_PAPAN) Zinc finger CCCH-type containing 12D {ECO:0000313|Ensembl:ENSPANP00000022244} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=ZC3H12D OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence length 526
Sequence
MEHSSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEYPAAPRLVP
RGSCGALDSAQRGPGTALEEDFGALASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDW
FRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDD
RYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGP
SLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPG
AGAEEQLPPRAPGGPAGARAAPREPVAHSLPLARGSPDLVALQGSFSRLAFSDDPGPLGP
PPPGHACGLTPRLGGPDWVSAGCQVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR
DLHGDLLSSRRLPDDPWARLPRSDRFPGRSAWAEPAWGDGATGGLSGYAAEDEGEARARA
RIALYSVFPRDQVDRVMAAFPALSDLARLILLVQRSQSAGAPLGKP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]