dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2I4P5X8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2I4P5X8|A0A2I4P5X8_CLOBO) Collagenase {ECO:0000313|EMBL:APR00903.1} OX=1491 OS=Clostridium botulinum. GN=RSJ2_1630 OC=Clostridium.
Sequence length 1095
Sequence
MKKKFIKMICSIAIGCMISTSCIAKVSAAPTNNTKINSNEINISEDSSKSERMPSTDSEP
LGLNAKNTNSSKYSFSDLNKLSNKEILDLTSKIKWNDISDLFQYNDDSYAFYSNRERVQA
LIDGLYEKASTYTSTDDKGIDTLVEILRSGFYLGFYNDSLKYLNNRSFQDKCIPAMLAIE
NNKDFRLGEKGQDTVINALGKLIGNASCNAEVVNKTVPILEQYYREMNKYPRDKLKADAV
YSLMKEINYDISEYAYDHNIRDGKNTPWSSKIDPFINTISKFAGISKVTEDNGWIINNGI
YYTSKFAIYHSNPSIPHSVIDKCLEILPAYSEQYYFAVERIKEDFNSKDSKGNVIDIDKL
LEDGKKHYLPKTYTFDNGKMIIKAGDKVDESKIQRLYWASKEVKSQFHRIIGNDKPLEAG
NADDVLTMVIYNSPEEYKLNRTLYGYSVDNGGIYIEGIGTFFTYERTPEESIYSLEELFR
HEFTHYLQGRYLVPGLFNEGDFYKGNSGRITWFEEGSAEFFAGSTRTSVLPRKSMVGGLS
QNPKERFSADKILHSKYDDGWEFYKYGYAFSDYMYNNNKKLFSDLVSTMKNNDVKGYENL
IEKSSKDFKINKDYQDHMQKLVDNYDSYTIPLVSDDYMKKYDNKALDEIKSDIEKTIGLT
NSQITKENSQYFDTYTLKSTYTLDSNKGEIDNWNCMNNKVNESLEKLNKLGWGGYKTVTA
YFSNPKVNSYNQVEYNVVFHGLLTHNKNFNEAPTIKLDFPKKSNTDEKIKFSSEGSTDDG
KIVSYAWDFGDGETSSEKNPTHAYKTPGTYTVKLTVTDDKGLKAEKTSSITINKVLKGNV
VSEKEDNNDFTNANPVYSKDLVNGSVSSSDNKDTFYFTVTKPSDITITVEKTNKDKSEFN
WLLFNDEDKSNYIAFPNKKLGDQLSNTVKIDKPGKYYLVIYKTLGEKVDYKFSIEGDILA
SPEGDKDKLVISEKENNDSFDKANRVGKNQTVIATLDTNDNRDTYYFDALTAGTVDVIME
NTDNNTNTFNWLAYSSDNTNNYIGYPTKKEGNKIMGSFKVPKPGRYYILAYKNSSNKINY
KLNINGDIDTAPLEN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]