dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2J8M2F1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2J8M2F1|A0A2J8M2F1_PANTR) ETNPPL isoform 8 {ECO:0000313|EMBL:PNI53705.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0024105 OC=Catarrhini; Hominidae; Pan.
Sequence length 70
Sequence
MGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDL
ALRLARQFRG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]