dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2K6DXH6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2K6DXH6|A0A2K6DXH6_MACNE) Solute carrier family 26 member 6 {ECO:0000313|Ensembl:ENSMNEP00000040620} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=SLC26A6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence length 651
Sequence
MGLADASGPRDTQALLSATQAVELRRRDYHMERPLLNQEHLEELGRWGSAPRTRQWRTWL
QCSHARARALLLQHLPVLVWLPRYPVRDWLLGDLLSGMSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVVLEVCRKLPQSKVSTVVTAAVAGVVLLVVKLLNDKL
RRQLPMPIPGELLMLIGATGISYGMGLKHIFGVDVVGNISAGLVPPVAPNTQLFSKLVGS
AFTIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLV
QESTGGNSQVAGAISSLFILLIIVKLGELFRDLPKAVLAAIIIVNLKGMLRQLSDVCSFW
KANRADLLIWLVTFAATILLNLDLGLMVSVVFSLLLVVVRTQMPHYSILGQVPDTDIYRD
VAEYSEAKEVPGVKVFRSSATVYFANADFYSDALKQRCGVDVDFLISQKKKLLKKREQLK
LKQLQKEKKLQKQAASSKGASVSINVNTSLEDMRSNNVEDCKVMVSPGDKMEDATANGQE
DSKAPDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFRDIEVEVYMAAC
HSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]