dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0B9J0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0B9J0|A0B9J0_METTP) Periplasmic binding protein {ECO:0000313|EMBL:ABK15364.1} KW=Complete proteome; Reference proteome OX=349307 OS=101360 / PT) (Methanosaeta thermophila). GN=Mthe_1596 OC=Methanosaetaceae; Methanothrix.
Sequence length 339
Sequence
MKGAYFLLAFLAIGMILSVPPISAYDFTLEIFGNANMDDAINEEDVAYIQGILNNEDKVT
EFADANYDGKIDSNDIDQIEAIIHNEEKELTLLDSAGRVATIKMPIKRIVAINRNGAETL
RTLKASDRIIGISDSALNDKSYFPEFREDQSIGSAKTPDIEKILNLDPDLVIYYGTQWTT
DYEIIRDTLNKTDPTISIIGLDCYKPDTYIEDVIKLGYIVGRVTEAYEFASWYEDKINTI
NNVVKQIPDDAKPRVYEGGRSDFYQTGGLGSQSHNVIVMAGGKNIFDDLSGEAITIDPES
VVERNPEFIIWKISNIGGYTLDKNETVKFQEKLLCWITI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]