dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A1B916 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A1B916|A1B916_PARDP) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ABL72010.1} KW=Complete proteome; Reference proteome OX=318586 OS=Paracoccus denitrificans (strain Pd 1222). GN=Pden_3944 OC=Rhodobacteraceae; Paracoccus.
Sequence length 211
Sequence
MKDAYSLILSAIDNGSYRPGDRLVESELAERFGVSRTPVREALQRLETQSMLKRDGRSLI
VATLDHNQLAELYTVRAELEALAARLAARHATPEEVRVLAGMVEDDRAILGDPQALARAN
RRFHHQIHLASHNRYLVQQLDLVHRSMALMARTSLAAQGRDVVTLDEHQAIVDAIAAHDG
AAAEQALRHHISMAFETRLKEEARLADEEED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]