dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A2BUE7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A2BUE7|A2BUE7_PROM5) NifS-like aminotransferase class-V {ECO:0000313|EMBL:ABM71408.1} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_01991 OC=Prochlorococcus.
Sequence length 381
Sequence
MFSSPILLDYQSSTPCLEDVVNSMSPYWREIFANTSSKSNLAGINASAILEVSREKIQEY
LCLKKKKVIFTSGATESNNLALLGFARNFYKETKSYGHIITLKTEHKAVLEPLDQLRKEG
FHITAITPEKDGLISKEKFMSFIRDDTFLVSIMMANNEIGVIQPLKEISEICKSREIILH
SDYAQCLGSLELDNLDSVANMLTISSHKIYGPKGVGLLLIDRDIELQPLFFGGGQEFGLR
SGTLPLALIVGFTKAIEIAVFNQKKNAEKFLFYRDKLLHGLLVNNSGVEINGSMKERLPH
NLNLTVLDVNGSKLHKTLKSKIICSSGSACGNGEPSHVLLALGRSFKEAEASLRLSIGLM
TTSEDIENSIQIITDTINLLR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]