dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A2BUN9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|A2BUN9|GLYA_PROM5) Serine hydroxymethyltransferase {ECO:0000255|HAMAP-Rule:MF_00051} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_02911; OC=Prochlorococcus.
Sequence length 423
Sequence
MNILQNLKKSDPIISNLINSEKNRQETHLELIASENFASMAVMQAQGSVLTNKYAEGLPQ
KRYYGGCEFVDEIEELAIERAKQLFDADWANVQPHSGAQANAAVFLSLLNPGDTILGMDL
SHGGHLTHGSPVNMSGKWFNAVHYGVDKETNKLNFNVIRDIALATKPKLIICGYSAYPRT
IDFKSFRSIADEVGAFLMADIAHIAGLVASKLHPNPIPYCDVVTTTTHKTLRGPRGGLIL
CKDKEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFGEALQPNFVNYSKQVIKNAKVLSSTL
INRGIDIVSGGTDNHIVLLDLRSINMTGKVADLLVSEVNITANKNTVPFDPESPFVTSGL
RLGTAALTTRGFNDEAFIEVGEIIADRLLNPDDLLIEKECKERVLSLCNSFPLYEAKLES
SIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]