dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A3DJ31 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A3DJ31|A3DJ31_CLOTH) Glucanase {ECO:0000256|RuleBase:RU361166} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_2761 OC=Ruminiclostridium.
Sequence length 707
Sequence
MKKIGILVLITALLAGIIPKSALAEEPKFNYVDAFAKSILFYEANWCGPDAGNNRIKWRG
PCHIEDGKDVGLDLTGGFHDCGDHVKFGLPQCASASTLAWAYHEFSDVFIEKGQDEYMLN
ILKHFCDYFMKCYPEKNKFYYQVGDGDVDHQYWGPPELQSYDRPTYYVATPENPGSDVAG
DTAAALALMYLNYKDRDLEYAEKCLAYAKDIYEFGMTYRGNSKGQSYYLPRDYLDELMWG
SLWLYVATGEQKYMDNLEKLMVEKRIGDEAGNSFNDNWTQCWDYVLTGVFIKLATLTDKP
LYKQIAEDHLDYWQNRIKSTPGGLKYLDSWGVCKYPAAESMVQLVYYKYTGDKRCLDFAK
SQIDYILGDNPKKMSYVVGFGDNYPKFPHHRAASGRLEGPPADETKNDPQRHILYGALVG
GADINDEYYDDIDKYVYSETGLDYNAGLVGALAGMSKYFGQGQMPEDTPGIEGEPPVYYA
DAKIYEENESGITVDLNMYNIVTSPPQYESDLSCRYFVDLSEYAGENIDMSKFVTKVYYS
PAGATISELKPYDKEKNIYYVEISFPNPVYARTYVQFCIYYYENKLWDSSNDFSYQGIGD
TYKTLENIPIYKNGVLVAGKEPSGAGPVEPTPPPKNYVYGDVNGDGKVNSTDCSIVKRYL
LKNIEDFPYEYGKEAGDVNGDGKVNSTDYSLLKRFVLRNIDKFPVEQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]