dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A4HLZ2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A4HLZ2|A4HLZ2_LEIBR) Transcription elongation factor-like protein {ECO:0000313|EMBL:CAM40841.1} KW=Complete proteome; Reference proteome OX=5660 OS=Leishmania braziliensis. GN=LBRM_33_3090 OC=Leishmaniinae; Leishmania; Leishmania braziliensis species complex.
Sequence length 474
Sequence
METYAPGDRVWVYIEGDGWWPARVLSDEEMGTRTPGLDLAVQFYAGVEQPATLYELNSHA
DAANICFFETSSEKAVTGNPELEASIRHASADAEANPLKSASAMVVGTRVAAGGSGAAGN
LGAVAVNRAAAKRVRDTGDGSMGTYDGGAATSRPVSGYHHLRSEELHELSRKISSAVAAQ
DVATVRAVLCRLDSVDVYLTELEDTKIGVAVGSVLSQLELKPLWPLARAMVSFWARHLPP
ETLAAIRSVQQRQLSFPPIGASAAASATQHSSPLGKQQRVSFALPGESAFTSSVSPSVTT
TAAGAGAAVSVDSGVVASPQGKTFYDNVYQLLDSPLSTMRYDDAVIEKVARKLAAEITDR
DERQLLLLRLREEELSFIRDNLLSGEWTPKKYLDQPNEVFTTKSEKARQEQRIQEKIKAI
EAADNARLNITALFKCGRCGKRHCTFYEQQTRSADEPTTKYITCLDCKNTWIQE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]