dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A5DTH4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A5DTH4|A5DTH4_LODEL) Uncharacterized protein {ECO:0000313|EMBL:EDK42482.1} KW=Complete proteome; Reference proteome OX=379508 OS=NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus). GN=LELG_00660 OC=Candida/Lodderomyces clade; Lodderomyces.
Sequence length 374
Sequence
MNSELTKLTNQVCKKWKSVGDVVTKPNCHQVDWKAIKHTPQYLKLKIKYAGVSYTVDEDF
DKLENILKSQSVSLKKLIEQTKQFTSSMVDTIQNAIAVSKCFHDTIDPCSNAHSNVPIFG
DTYDKWANMVKYKQLVQAISIESEIVYLNNGTLKQLELLNNQILKQVFKMIRERRYAALD
CDKLSNEHKTLAEKQSNIGGADQLSSRETSHIFAIGRKLFDAKKKYNYYNALLKKELPSL
ILLIKPIISYATTDLYLLHLNYCYSWIIKLNNIPYKDVPMEKLLRDSETKQVELDAEVRG
LKLFTPMQKDGHTVCTQTNASWSCIALYDYDGLQDDDLTFKRNDTIKIIAKDNDNWWKGE
VKGKVGYFPSNYVF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]