dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A6ZV34 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A6ZV34|A6ZV34_YEAS7) Tau 131 subunit of transcription factor TFIIIC {ECO:0000313|EMBL:EDN61642.1} KW=Complete proteome OX=307796 OS=Saccharomyces cerevisiae (strain YJM789) (Baker's yeast). GN=SCY_2267 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence length 1025
Sequence
MAAGKLKKEQQNQSAERESADTGKVNDEDEEHLYGNIDDYKHLIQDEEYDDEDVPHDLQL
SEDEYNSERDSSLLAEFSDYGEISEDDEEDFMNAIREASNFKVKKKKKNDKGKSYGRQRK
ERVLDPEVAQLLSQANEAFVRNDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLND
CCNSWFLAAHLNASDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRSMLY
KKTGQLARALDGFQRLYMYNPYDANILRELAILYVDYDRIEDSIELYMKVFNANVERREA
ILAALENALDSSDEESAAEGEDADEKEPLEQDEDRQMFPDINWKKIDAKYKCIPFDWSSL
NILAELFLKLAVSEVDGIKTIKKCARWIQRRESQTFWDHVPDDSEFDNRRFKNSTFDSLL
AAEKEKSYNIPIDIRVRLGLLRLNTDNLVEALNHFQCLYDETFSDVADLYFEAATALTRA
EKYKEAIDFFTPLLSLEEWRTTDVFKPLARCYKEIESYETAKEFYELAIKSEPDDLDIRV
SLAEVYYRLNDPETFKHMLVDVVEMRKHQVDETLHRISNEKSSNDTSDISSKPLLEDSKF
RTFRKKKRTPYDAERERIERERRITAKVVDKYEKMKKFELNSGLNEAKQASIWINTVSEL
VDIFSSVKNFFMKSRSRKFVGILRRTKKFNTELDFQIERLSKLAEGDSVFEGPLMEERVT
LTSATELRGLSYEQWFELFMELSLVIAKYQSVEDGLSVVETAQEVNVFFQDPERVKMMKF
VKLAIVLQMDDEEELAENLRGLLNQFQFNRKVLQVFMYSLCRGPSSLNILSSTIQQKFFL
RQLKAFDSCRYNTEVNGQASITNKEVYNPNKKSSPYLYYIYAVLLYSSRGFLSALQYLTR
LEEDIPDDPMVNLLMGLSHIHRAMQRLTAQRHFQIFHGLRYLYRYHKIRKSLYTDLEKQE
ADYNLGRAFHLIGLVSIAIEYYNRVLENYDDGKLKKHAAYNSIIIYQQSGNVELADHLME
KYLSI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]