dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A7UFI1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A7UFI1|A7UFI1_LEIPE) Glucose-6-phosphate isomerase {ECO:0000256|RuleBase:RU000612} OX=5681 OS=Leishmania peruviana. GN=GPI OC=Leishmaniinae; Leishmania; Leishmania braziliensis species complex.
Sequence length 581
Sequence
MATATFNAPYEIARKTKVLGASDSSLSKLSAWKRLEFLYEKYGNESILSHFEKDQQRFSR
YSIEVPLQCDDNFLFLDYSKSHINDEVKDALVALAEERGVRAFIKAMFDGQQVNSTEKRA
VLHVALRNRSNRAINVNGKDIMTDVNLVLAQMKDFTDKVRSGEWKGQTGKSIHYIVNVGI
GGSDLGPVMVYESLKPFSMRDMHCFFVSNVDGTHMAEVLKQVNMEETIFIIASKTFTTQE
TLTNAMSARNAFIDYLKSNNIPSDGAVAKHFVAISTNAKEVREFGIDTANMFEFWDWVGG
RYSVWSAIGLSVMLSIGYENFVEFLTGAHVIDNHFASAPVEQNLPMMLALVGIWYNNFFG
AETQAVLPYDQYLWRLPAYLQQLDMESNGKGVTKKSGAVTVQTGPIIFGEAGTNGQHAFY
QLIHQGTKIIPCDFIGCVQTQNRVGDHHRILMSNFFAQTEALMVGKSAEEVRQELVKSGM
PSDAIESLLPHKTFTGSRPSNSILVNALTPRALGAIIAMYEHKVLVQGAIWGINSYDQWG
VELGKVLAKSILPQLKSGNIVSNHDGSTNGLINMFNTRAHL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]