dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A8GBM2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A8GBM2|A8GBM2_SERP5) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ABV40512.1} KW=Complete proteome OX=399741 OS=Serratia proteamaculans (strain 568). GN=Spro_1408 OC=Yersiniaceae; Serratia.
Sequence length 301
Sequence
MSRTQNLRHNVVNQMIDGINNNHLRSPLPSQAALAEMYNISRTTVRHTLTHLFQRGVLEK
VGDDYVILRQPQPEDGFDCQSPSLDEQGKRFEKAFYQMINQKQLRAGDSFSELQLARAVN
VSPVVVREFLLHFSRYNLIESSKRGQWRMKQFDQRYAEQLFELRQMLETHALSHFINLPA
HDPRWLQARELLSRHRQLREDISDNYRLFSQLDRDFHLLILSAANNPFFNQSLEIISVIF
HFHYQWDETDLKQRNIIAIEEHMTILSALICRNDQEAINALHRHLDTAKQSMIRSLNQTI
A

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]