dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A8Y3U3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A8Y3U3|A8Y3U3_CAEBR) Protein CBR-TWK-14 {ECO:0000313|EMBL:CAP39562.1} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG23471 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence length 438
Sequence
MAITETVMHKLQFARGIGQREMLRANTLPSITRAKVGCFARLRIYEENARFVLICLILIV
YLAFGAALFHWLEWDNEVDERETIEKRMNEYRENYCTRRPMNECDFDEMVRFIADGATSG
LLNTRPRFDILGSLFFSATVISTIGFGTSTPRTQLGRFITIVYGVVGCTCCVLFFNLFLE
RLVTGMSYILRSLRERKIRYRLKEPGNKPVTLLINNEDFNESSSSCEGHMDNWRPSVYKV
FFILFSMCLVLITASAGVYSVIEDWVYIDSLYFCFISFATIGFGDYVSNQQDVTRMSPDL
YRFVNFCILTLGACFFYCLSNVSSIVVRQLLNWMIKKMDIKVEDRSFLCFKKKRRYMGLG
LRPPKGYDMTSERSSVDYADGLLSLKEFLMNNQSSMIMLQKQLIKSAMKNVVENEEQKIS
ATRVGPMGILDEAFGDEP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]