dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A9A532 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A9A532|A9A532_NITMS) Homoserine kinase {ECO:0000256|HAMAP-Rule:MF_00384} KW=Complete proteome; Reference proteome OX=436308 OS=Nitrosopumilus maritimus (strain SCM1). GN=Nmar_0041 OC=Nitrosopumilus.
Sequence length 307
Sequence
MASKVTVKAPSSTANLGPGFDVFGLAVDAFYDEVTLTKTKSRITIVTDDNIPTKPDNNTA
GLVVKNMKKKFKIKSGVEIKIKKGVPAGFGMGSSAASAAATAVAFDKLFGLKLDGNSLVE
FAGSGEKASAGSVHYDNVAASVLGGFVIVKTNPLQVTRVDPPTNLRMCVAVPKLEVPKKK
TKVSRGVIPKKVKLTDSILNLSNASAIVAGFMKKDPELIGNSIKDVIVEPARKHMIPGFD
KVKENALKAGALGVTISGAGPSVIAFSKSSADLKKISSAMSRGFASAKTECQTVICKPSK
GAADKRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]