dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B0BZK8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B0BZK8|B0BZK8_ACAM1) Lipid-binding protein {ECO:0000256|HAMAP-Rule:MF_01396} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_0892 OC=Acaryochloris.
Sequence length 81
Sequence
MDPLVAAASVLAAALGIGISTIGPALAQGNAAGKAVEGIARQPEAEGKIRGTLLLCLAFM
ESLTIYGLVIALVLLFANPFA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]