dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B0C205 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|B0C205|BIOF_ACAM1) 8-amino-7-ketopelargonate synthase KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=bioF; OC=Acaryochloris.
Sequence length 394
Sequence
MAAYDWIESALATVHKANWYRSVKTMSSPGPTAVLNGQTVINFASNDYLGLAGDSRLAEA
AIAAINTYGTGSTGSRLLSGHRMIHEQLERAIATWKQTETAIVYSSGYLANIGTITALVN
KRDLILADAYNHASLKNGARLSGATIHEFGHANVTELQTLLETHRSHHRRCLLVTDSVFS
MDGDLCPLPELIALAEQYDCMLLIDEAHGTGVLGKTGAGCVEHFGCRDAELIQMGTLSKA
LGSLGGYVAGSASLIDYLRNRSSSWIYTTGLSPADTAAALAAVEIIREGSELRSQLWQRV
TQLKQALTTHLAPEDEHQTMQLLPSESPILCVQMPTPAAVLTASQQLLDQGIFAPAIRPP
TVPTSRIRISIMATHQAVQIDQLIVALSEVAQGS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]