dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B0JUD1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B0JUD1|B0JUD1_MICAN) Transketolase {ECO:0000256|RuleBase:RU004996} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_14970 OC=Microcystaceae; Microcystis.
Sequence length 668
Sequence
MVVASQSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWV
NRDRFVLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTG
PLGQGIANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWG
LGKLIALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKA
VTDKPSMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWEYEPFVVPDEVLNR
FRQAVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALA
SRKHSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNFQKGSYQERNVHFGVREHAMG
AICNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQ
PVEHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNLPNLAGTSLDGV
AKGAYIITDSEGTPDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAEY
KESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVNNVV
AKAKALLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]