dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B0Y1T2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B0Y1T2|B0Y1T2_ASPFC) Translation initiation factor eif-2b delta subunit {ECO:0000313|EMBL:EDP52041.1} KW=Complete proteome OX=451804 OS=(Aspergillus fumigatus). GN=AFUB_060750 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence length 556
Sequence
MATPINPPVPSSTSESATTAPAQQQSTSEMQPQQQQPPREPKGAAKNASKPAKQSQNPKE
GTPAADGASPADAGSQKLTPAELKKKAKAEKAARRAKERAEREQAGGAAPAQGANPPFAK
KGQTGAGGGGGAGGKDAAAAQSQKGRGYLPRRGSAQAAAGGAEQKKKQEDKNVAVFGHLY
GQQRRTTVAGAGKEVHPAVLALGLQMRDYVICGSSARCVATLLAFKRVIESYTTPLGTSL
ARHLTTHLSHQITYLSTCRPLSISQGNAIRALKLAISSIDPSVPEASAKASLSDFIDSFI
REKITVADQVIADSAAQKIQDGDVIVTYAGSSIVKQTLLTAHKQGKKFRVSIIDSRPLFE
GKNLARTLAKAGLEVQYSLVNGISHAIKDATKVFLGAHAMTSNGRLYSRVGTALVAMSAK
ERAGGVEVPVIVCCETVKFTDRVALDSIVVNEIADADELVMNEPLQQVTGLPDAAAVAQP
EPKKGNKSAANATPSESTVVTPGTSPLKDWKDTPNLQLLNIMYDVTPAEYVDMVVTEMGS
LPPSAVPIVHRMSTNM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]