dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B1L6U1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B1L6U1|B1L6U1_KORCO) Pseudouridylate synthase {ECO:0000313|EMBL:ACB08170.1} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_1424 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence length 359
Sequence
MEVPPIDSHLGMLTYMSGGSPINGRLREKLSDFIVDEVLLGKRASRAFLGIDKFEGGGVS
YLVVMKRVRMDSFEMISKLSKKLGRRVGYAGMKDARSISFQFISVQGSLRELPEMEGLSL
RYAGRGEMIYLGMNDGNHFTVVIRGADTIELPKIFPNFFSYQRFGVKRPYNHEIGKAILL
RDIEGASSMISEQGYEVSAARSLKQLSEMIGSELIRFYVHSYQSYIFNLILSRRIELGID
PRHGDFVLRPNGEIALYPERGSLLLPLVGGLTEARGWLAEELASILREEGVSKEMFIFRE
LPEVSALGDFRKAFCEVEPKIVEREGFIVLSFFLESGAYATSYLREIIKPRDPIAQGFI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]