dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B2IZY3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B2IZY3|B2IZY3_NOSP7) Uncharacterized protein {ECO:0000313|EMBL:ACC81754.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F3316 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence length 406
Sequence
MIAAIRQKIRSAYADNPHLALCHWFHEFDNYVDSDNFAVCEGLLSEICKEAYPPLAAKEQ
AYVDSREGVLWLKKGIEHHKQSRFEEAQNYYQKSLKIQQRVQCRDAQTNVKVFQSVLAED
CLNGTPSYLKLDSFAQELHVLGGSESLLCDRLSTSTTPEERSQILFAAVQARLTKPLVQA
FRSPDEQTRMMGIAGLGRFKQINETQVLLEGLYDSNWFVRWRAAEALAHQIVICSACNSE
NPIGIKSCQACPADINLPEVTTDLFIQKLCAVLDRETSPDVRRVLVMLLGQTNNTGVTLT
LLAALDDSDADVRIAVIEALGKIGVPSGTIEKLRNVSDGKSLLGGSIKETLEKIIGTIAD
QSLRSETAIATYIVSQDGDGDYGTISKAIASVPPGSRILVQPGLYN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]