dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B4HYU0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B4HYU0|B4HYU0_DROSE) GM12583 {ECO:0000313|EMBL:EDW52220.1} KW=Complete proteome; Reference proteome OX=7238 OS=Drosophila sechellia (Fruit fly). GN=Dsec_GM12583 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 444
Sequence
MSDNDDDFMCDDDEDYGLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDL
ENGEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYI
STSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSC
QTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRE
CGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEA
KPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVL
IKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINSSAS
RYNALEKWSNQIQSLQFAVVQKMA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]