dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B4PVX7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B4PVX7|B4PVX7_DROYA) Uncharacterized protein {ECO:0000313|EMBL:EDW99282.2} KW=Complete proteome OX=7245 OS=Drosophila yakuba (Fruit fly). GN=Dyak_GE14532 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 2072
Sequence
MELMPKRNYKQLQYTKTKIIMLRNEFYCANLIHVLHGLCIITIIGSQHYSVSCFEELPAQ
VMSPLNDIVAQFNLPSIPAQSTESPYGNRSIGNQVENVGDSQSKNYFTHLSFDFMHNVIF
AGATNKILKLNENLRVLAEAVTGPVHDSPQCHAGGCPEEIETSLVNNFNKILVVSYAHDG
ILIACGSIRQGACEIYSLPRFPAPPEFFAVPLAANDENASTYAFVGPSRYTWKEEDILYV
GTTFTNVGDYRHDVPAISSRRLDDLNYAEFSIQQSIINIDVKYRDHFLVDYLYGFNSSEY
AYFIIVQKKSHLADEAGYVTRLARICITDPNYDSYTEITIQCTATENNVDYNILRDAKIT
TASHKLAQKMGIKKDDHVLITVFSPSKEISNQPESKSAMCIYSIKDIEDMFIENIHLCFN
GTIKDRNLGYISGTINDGRCPIVGSLGNIYNFCSVGLKISGVSPITAHALFHFENVSVTS
VTATSTTDQQHSLAFLGTSKGVIKKVLLSGQSPGEYEEIVVDAGNRILPNTMMSPKKDFL
YVLSQRKITKLRIEHCSVYTNCSACLESRDPFCGWCSLERRCTVRSTCQRDTSASRWLSL
GSGQQCIEFESIIPDKIPISELTHLHLIIRTLPEPFNAKYRCVFGNSTPIDAEILENGLG
CATPPLNERPLIPTNTDHILVPLSVRSSETNKDFVSRYFAFFDCSHHGKCQECLQSSWGC
NWCIFDNKCVHKSLQCRNIENSVSTLGHCPHLKKNRPEILIPVRVPIEIRLEIENLPKPK
STHAGFLCTIHIEAAQMLLPAHVESNKIVVCEKTPYFYETNAHEYQAKVVVTWNFQHYVD
TAIVTLYKCDVLGSHREHADCSLCVTRDPKYKCAWCSNSCVYNETCIANRISSSSGSEAA
IENECPLPRIDIIKPLSGPVEGGTLITIEGSNLGIREEDVRGKIFIGSVPCELENYQISV
KIECRTGAALYEMSAPIKVANDAGYTESSVQFHFKNVLLTGLYPTIGPRSGGTQLSLIGK
FLNIGSTMRAFLDEYECHIDVTQASSSQVSCTTSEATQPEPIRSLHLVIDGANRTLECHL
SAPSITNTNPNRSNFGSYQLRTPPRQPCSIFNYTQDPRIMQIKPLRSFVSGGRVLTVHGI
YLNSIQKPELEVFYDNERVNKTSCVVINSNQMECPSPPVNYKFETFKKTNRVPDTELHLQ
NLSSPTESRFKNEYDRKKRLTDFGDNFRIYTTGGTSASYFVNNNMDVTTFVKVHETQLNL
QISFVMDNVQLVRNLNKYFHDIRSTIVYLADPKYLAFPNDGVKLYKGDSLVIEGELLNLA
ADEYDVNVTIGTSQCNITSLALTQLLCIPPEQQPLPTDENGVDQSTDLPLVVVKVGRNLR
FVIGYLKYDLNKPYVFSHALFVVILTVALLVIVFVTVLIIFRRKSTQAEREYKRIQIQMI
TLESNVRSECKQAFAELQTDMTDLTADLESTGIPTLDHVNYIMKVFFPGVSDHPILNSPK
FRGGVPQTNYDAAMIQFEQLIGNKYFLLMFIETLEAQRSSFSIRDRVNVASLLMVVLMNK
MEYATEILKSLLLRLIDKSLTSKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEYAGSNL
FLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVN
DWDTISQVKLKILDAIFKNTPFSMRPSVHEVDLEWRHGRGGHLTLQDEDLTTKTVNGWKR
LNTLAHYGVKESAVMSLIARQNDNYHIPYSKNQNSAPYHNFYFINNSQSHIIINNDIESG
LQQPRLYHLVKPNIPDHYMNIKNSVLSGGSPAFQSSHVVSNCIDRVNKTIPEVYLTRLLA
TKGTIQKFVDDFFSIILTVNEELPPAVKWLFDLLDEAARRHDIADTEIVHAWKSNCLPLR
FWVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLGKDSPSNKLLFAKDIPN
YRIMVKEFYRDVSKLPQISDQEMSTAMQQLSVRQNEEFDTISALKELYIYITKYKDQIME
SLETDINCRKMHLSRKLGNVAAILDGDCTSNC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]