dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B4QWM6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B4QWM6|B4QWM6_DROSI) GD20797 {ECO:0000313|EMBL:EDX13630.1} KW=Complete proteome; Reference proteome OX=7240 OS=Drosophila simulans (Fruit fly). GN=Dsim_GD20797 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 340
Sequence
MMKRQNVRTLSLVVCTFTYLLIGAAVFDSLESPTEAKRWDFLQTVKNNFVRKYNVTDEDF
RVMEIVIIENKPHKAGPQWKFAGAFYFSTVVLAMIGYGHSTPVTIPGKAFCMGYAMVGIP
LGLVMFQSIGERLNKFASVIIRRAKRASGARCTDATEMNLMLATGMLSSIIITTGAAVFS
RYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPGYVALSLVFILFGLAVVAASI
NLLVLRFMTMQAEDAKRDEQDAQNLAGNAQPVTFDDESTYNTHGKLLENNYTTENDETAS
LCSCTCMGGTRCLNHEQFVDPDFQPTDIIESTLCLKRASV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]