dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B7JYK7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B7JYK7|B7JYK7_CYAP8) Putative PAS/PAC sensor protein {ECO:0000313|EMBL:ACK64877.1} KW=Complete proteome; Reference proteome OX=41431 OS=RF-1)). GN=PCC8801_0795 OC=Cyanothecaceae; Cyanothece.
Sequence length 817
Sequence
MNHWRILLTKKWANLSLRAKIILAFFSLMIVSTTTVTVFSYRVLRIELTAQVGKDLQKQA
TKLAQQVSNLLINQVDQVTLISLSNVFQNELNLINSRYPKNQNTIQQEIQKNSQIWHQSK
KSNRLLGNYLNNPISRELREYQKHFPNNYQIFVTDKYGAIAGTTNLNLEYNQGEKQWWQQ
TWNNGRGAVYIEEPQYNQENLLLLVNIAVPIYKRSNSQASEVIGIIHTSYKISHALLPLL
QNINSGKTGHAYLFVSPKKYFSDYKFVNETNQELTKFISSLASYKEIKYQGEKRFFSKAS
VQPKNQEFSLLNNLPWLIIIYQDSSEILHPLIIARQTIMMAALGTLLVAGILASFIERLI
STPIRVLTKITQRIASGDLDYEIDLEQKDEIGLLAANFNIMVESLKSYFSKLRTSLKELS
DMKFALDQSVLVTVMEPNGRITYVNDKFCEISQYSRQELIGNNYRFLKSRYHTPEFYQSI
WDTLNQGNIWRGEIKNQTKDGSYYWVDSTMVPFLDENNKPFQYLAIRYDITARKDFEEAL
SQKVKERTDQLAQANQEIIQLNHQLQGENLRMSAQLNVARQLQQMVLPKPEELAAIKGLE
LAGFMEPADEVGGDYYDVLATDDVVTISIGDVTGHGLESGILMIMTQTVVRTLKEIREHD
PVKFLDTLNRTLYRNIERMNSDRHLTLAVLNYSHRRVSLSGQHEEVIFVRAGGELQRIDT
MNLGFPIGLDQNITDFIDQISLELQTGDGLVLYTDGITEAKDINKNHYGIERLCQVIQQN
WEKSAQQIQELVIQDLHEHIGQQKIFDDITLFVLKQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]