dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B9LPG1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B9LPG1|B9LPG1_HALLT) Peptidase M28 {ECO:0000313|EMBL:ACM57249.1} KW=Complete proteome; Reference proteome OX=416348 OS=ACAM 34). GN=Hlac_1664 OC=Halorubrum.
Sequence length 479
Sequence
MHSEPNETNAAVDPAAVERVRERRTELAPALGRTWTDGDPWRFLTDLTAIGSRMAGSEGE
RRAAEIVADAFERAGLSAVETRPFEMAAWERGSATLRVTAPGRDGAAATREFEALALPYS
PGGSVTGELVDVGYGTPAEIDEREVEGRIAVASTTTPEGGRFVHRMEKFGYALDAGAVGF
VFVNHLDGQLPPTGSLTFGEEAEAVAVGVSKETGAWLREYAAGGDGGVAAESSPAAQAEL
SVTATTEPGESRNVVGHAGPDTDERLLLLAHYDAHDIAEGALDNGCGIATVATAAGILTE
ADLPLGVDVVAVGAEEVGLLGSEQLAERLDLDRVKGVINVDGAGRFRDLVALAHASETAA
SVAEAVSTATNQPIAVDAEPHPFSDQWPFVRRGVPAIQLHSDSGDRGRGWGHTHADTRDK
VDDRNVREHAMLIALLVAEFAAPERDAPRLDRDDLIAAFRDADFETGMRAADLWPAGWE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]