dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C7QHF2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C7QHF2|C7QHF2_CATAD) Ig family protein {ECO:0000313|EMBL:ACU69091.1} KW=Complete proteome; Reference proteome OX=479433 OS=102108 / JCM 14897). GN=Caci_0136 OC=Catenulispora.
Sequence length 622
Sequence
MKNTNTRRRAAAAGAAVATMAAGFGLLAATAQTAQAWEINPASCKHAPHSHKHGVQPTET
QTLCDRINAAGHAAPTGSETLSYGGGVDGIGVNSGKNQVYLVFYGSQWGTQTAGSNGVSS
FSGDPKGAAPAAQKMFKDIGTGGETWSADLTQWCDGPNVAAGATSCPSNAAFVPYQSGGV
LAGVWYDNSAASPAKASGHALGVEAVNAAAHFGNTTAASNRNAYYVILSPTGTNPDDYEN
PSTGYCAWHDYNGDTTLTGGAVASSYGDIAFSNQPYNIDAGQTCGTNFVNSGSAGTLDGY
TMTLGHEWHEMMSDKNPAGGWTNNTGSSYNGQENSDECAWLKPGTTGGAANVTLGSDTFA
EQASWSNDTNGCAMSHQILTHNGGGAVTVTQPAAQTSTVGSAVSLQIQASDSTSGQTLSY
TATGLPQGVAINSASGLISGTPTTAGSSSVTVTVKDTTGASGSATFGWTVNSTTGGGTVI
TNGGFENGSLSGWTTSGVTAATATGPHAGGYAAELGNLNPSSTSTIAQTFTAGAGNSRLA
FWYNVTCDDTVQYDWATATLKDNTTGTTKTVLAKTCTNPTSGWKQVTAAVTAGDSYTLTL
SNHDDNYAGDPTYTLYDDVAVS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]