dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C8ZJL5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C8ZJL5|C8ZJL5_YEAS8) Pzf1p {ECO:0000313|EMBL:CAY87146.1} KW=Complete proteome OX=643680 OS=(Baker's yeast). GN=EC1118_1P2_5325g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence length 429
Sequence
MGGEVLNNEGMPLAELKQETIPISRSESSESLNSLTSTRSSSSNRPKTYFCDYDGCDKAF
TRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTR
QQLKRHEVTHTKSFICPEEGCNLRFYKHPQLRAHILSVHLHKLTCPHCNKSFQRPYRLRN
HISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIKNDHPKLKCPICSKPCVGENGLQMH
MIIHDDSLVTKNWKCHICPDMSFSRKHDLLTHYGSIHTEEDIPLELKYKISDIQQLVQDH
GVQLGNSKHSNEQDEEKISNRLRKRRKLTENNNVEFLQNEVDLEKRLESGENGLNLLLNT
VGRKYRCFYNNCSRTFKTKEKYEKHIDKHKVHELKLKILQEKEENKTLVDQNHKEPFIIQ
KETQSAGDK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]