dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

C9SSF1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|C9SSF1|C9SSF1_VERA1) Ran-specific GTPase-activating protein {ECO:0000313|EMBL:EEY21716.1} KW=Complete proteome; Reference proteome OX=526221 OS=(Verticillium wilt of alfalfa) (Verticillium albo-atrum). GN=VDBG_07826 OC=Plectosphaerellaceae; Verticillium.
Sequence length 257
Sequence
MSAPEATEPKVEEPKIEAPKAEEAPATGTADAPATESTGEADKPVTAQSSVFSMFGGGAK
KEKKPEDEDRGDNSGSNKAQREAAAAAADDDQAPESEDVHFEPVHKLTEKVETATNEESE
QQLFKMRAKLFKFIKESSEWKERGTGDVRLLKHKENGKTRLVMRRDKTLKVCANHYIVPE
MKLSPNVGSDRSWVWNAAADVSEGEPEAATLAIRFANSENANLFKDAFLQAQKDNEALFK
KAEDGEASTETPAAEQS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]