dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

D1BQS9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|D1BQS9|D1BQS9_VEIPT) TonB family protein {ECO:0000313|EMBL:ACZ23892.1} KW=Complete proteome; Reference proteome OX=479436 OS=(Veillonella alcalescens). GN=Vpar_0205 OC=Veillonella.
Sequence length 115
Sequence
MNKVLRCIILSSLFVMSMVASVLAAPYDPPVAIATPPIDRALLSAYGEAAHGADIRFTIK
EDGSVGDVEVVSSSGSSALDAAIVDTISKWRFSPATDSNGRPVASSKTEYIDFKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]